POLR3H Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153025

Catalog No. NBP153025

Description

POLR3H Polyclonal specifically detects POLR3H in Human samples. It is validated for Western Blot.

Specifications

• Antigen: POLR3H
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B0QYH9
• Gene Symbols: POLR3H
• Immunogen: Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 171568
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide, DNA-directed RNA polymerase III subunit H, DNA-directed RNA polymerase III subunit RPC8, KIAA1665MGC29654, MGC111097, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD), RNA nucleotidyltransferase (DNA-directed), RNA polymerase III subunit 22.9 kDa subunit, RNA polymerase III subunit C8, RNA polymerase III subunit RPC8, RPC8RPC22.9
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: RPC8.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
• Isotype: IgG