Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. POMT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

POMT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen POMT1
Immunogen Synthetic peptides corresponding to POMT1(protein-O-mannosyltransferase 1) The peptide sequence was selected from the middle region of POMT1. Peptide sequence LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16005420 View Documents
View Product Certificates
Novus BiologicalsSupplier Diversity Partner
NBP16005420UL 		20ul Each for $149.00
Add to cart
 
NBP160054 View Documents
View Product Certificates
Novus BiologicalsSupplier Diversity Partner
NBP160054 		100 ul Each for $329.00
Add to cart
 
Description

Description

POMT1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

POMT1
Rabbit
Polyclonal
Unconjugated
10585
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to POMT1(protein-O-mannosyltransferase 1) The peptide sequence was selected from the middle region of POMT1. Peptide sequence LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL.
Primary
IgG
Dolichyl-phosphate-mannose--protein mannosyltransferase 1, EC 2.4.1, EC 2.4.1.109, FLJ37239, LGMD2K, MDDGA1, MDDGB1, MDDGC1, protein O-mannosyl-transferase 1, protein-O-mannosyltransferase 1, RT
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit