Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POTEH Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309621100UL
Description
POTEH Polyclonal specifically detects POTEH in Human samples. It is validated for Western Blot.Specifications
| POTEH | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| A26C3, ACTBL1ANKRD26-like family C member 3, actin, beta-like 1, ANKRD26-like family C, member 3, cancer/testis antigen family 104, member 7, CT104.7, POTE ankyrin domain family member H, POTE ankyrin domain family, member H, POTE22POTE-22, Prostate, ovary, testis-expressed protein on chromosome 22, protein expressed in prostate, ovary, testis, and placenta 22, protein expressed in prostate, ovary, testis, and placenta POTE14 like | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human POTEH (NP_001129685). Peptide sequence EEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMKKHGSTHMGFPENL | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 23784 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction