PPFIBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156315

Catalog No. NBP156315

Description

PPFIBP1 Polyclonal specifically detects PPFIBP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPFIBP1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86W92-5
• Gene Symbols: PPFIBP1
• Immunogen: Synthetic peptides corresponding to PPFIBP1(PTPRF interacting protein, binding protein 1 (liprin beta 1)) The peptide sequence was selected from the N terminal of PPFIBP1. Peptide sequence PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Canine: 92%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hSGT2liprin related protein, hSgt2p, KIAA1230, L2, liprin-beta 1, liprin-beta-1, Protein tyrosine phosphatase receptor type f polypeptide-interactingprotein-binding protein 1, protein-tyrosine phosphatase receptor-type f polypeptide-interactingprotein-binding protein 1, PTPRF interacting protein, binding protein 1 (liprin beta 1), PTPRF-interacting protein-binding protein 1, SGT2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8496
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG