Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPFIBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PPFIBP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156315
|
Novus Biologicals
NBP156315 |
100 μL |
Each for $436.00
|
|
NBP15631520
|
Novus Biologicals
NBP15631520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PPFIBP1 Polyclonal specifically detects PPFIBP1 in Human samples. It is validated for Western Blot.Specifications
| PPFIBP1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q86W92-5 | |
| 8496 | |
| Synthetic peptides corresponding to PPFIBP1(PTPRF interacting protein, binding protein 1 (liprin beta 1)) The peptide sequence was selected from the N terminal of PPFIBP1. Peptide sequence PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| hSGT2liprin related protein, hSgt2p, KIAA1230, L2, liprin-beta 1, liprin-beta-1, Protein tyrosine phosphatase receptor type f polypeptide-interactingprotein-binding protein 1, protein-tyrosine phosphatase receptor-type f polypeptide-interactingprotein-binding protein 1, PTPRF interacting protein, binding protein 1 (liprin beta 1), PTPRF-interacting protein-binding protein 1, SGT2 | |
| PPFIBP1 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title