PPIH Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157630

Catalog No. NBP157630

Description

PPIH Polyclonal specifically detects PPIH in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPIH
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43447
• Gene Symbols: PPIH
• Immunogen: Synthetic peptides corresponding to PPIH (peptidylprolyl isomerase H (cyclophilin H)) The peptide sequence was selected from the N terminal of PPIH)(50ug). Peptide sequence VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 10465
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cyclophilin H, CYP20, CypH, CYPHpeptidyl prolyl isomerase H (cyclophilin H), EC 5.2.1.8, MGC5016, peptidyl-prolyl cis-trans isomerase H, peptidylprolyl isomerase H (cyclophilin H), PPIase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, SnuCyp-20, USA-CyP SnuCyp-20, USA-CYPCYP-20, U-snRNP-associated cyclophilin SnuCyp-20, U-snRNP-associated cyclophilin SunCyp-20
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG