Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPIH Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PPIH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157630
|
Novus Biologicals
NBP157630 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PPIH Polyclonal specifically detects PPIH in Human samples. It is validated for Western Blot.Specifications
| PPIH | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cyclophilin H, CYP20, CypH, CYPHpeptidyl prolyl isomerase H (cyclophilin H), EC 5.2.1.8, MGC5016, peptidyl-prolyl cis-trans isomerase H, peptidylprolyl isomerase H (cyclophilin H), PPIase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, SnuCyp-20, USA-CyP SnuCyp-20, USA-CYPCYP-20, U-snRNP-associated cyclophilin SnuCyp-20, U-snRNP-associated cyclophilin SunCyp-20 | |
| PPIH | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O43447 | |
| 10465 | |
| Synthetic peptides corresponding to PPIH (peptidylprolyl isomerase H (cyclophilin H)) The peptide sequence was selected from the N terminal of PPIH)(50ug). Peptide sequence VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title