Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPM1J Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen PPM1J
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156765
View Documents
Novus Biologicals
NBP156765
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

PPM1J Polyclonal specifically detects PPM1J in Human samples. It is validated for Western Blot.
Specifications

Specifications

PPM1J
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp434P1514, FLJ35951, MGC19531, MGC90149, PP2CZ, PP2Czeta, PP2C-zeta, PPP2CZEC 3.1.3.16, protein phosphatase 1J, protein phosphatase 1J (PP2C domain containing), protein phosphatase 2a, catalytic subunit, zeta isoform, Protein phosphatase 2C isoform zeta, protein phosphatase 2C zeta, protein phosphatase, Mg2+/Mn2+ dependent, 1J
PPM1J
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q5JR12
333926
Synthetic peptides corresponding to PPM1J(protein phosphatase 1J (PP2C domain containing)) The peptide sequence was selected from the C terminal of PPM1J. Peptide sequence YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit