Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPM1J Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PPM1J |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156765
|
Novus Biologicals
NBP156765 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PPM1J Polyclonal specifically detects PPM1J in Human samples. It is validated for Western Blot.Specifications
| PPM1J | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp434P1514, FLJ35951, MGC19531, MGC90149, PP2CZ, PP2Czeta, PP2C-zeta, PPP2CZEC 3.1.3.16, protein phosphatase 1J, protein phosphatase 1J (PP2C domain containing), protein phosphatase 2a, catalytic subunit, zeta isoform, Protein phosphatase 2C isoform zeta, protein phosphatase 2C zeta, protein phosphatase, Mg2+/Mn2+ dependent, 1J | |
| PPM1J | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5JR12 | |
| 333926 | |
| Synthetic peptides corresponding to PPM1J(protein phosphatase 1J (PP2C domain containing)) The peptide sequence was selected from the C terminal of PPM1J. Peptide sequence YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title