Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPM1M Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen PPM1M
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15663020
View Documents
Novus Biologicals
NBP15663020UL
20 μL
Each for $152.22
Add to cart
 
NBP156630
View Documents
Novus Biologicals
NBP156630
100 μL
Each for $436.00
Add to cart
 
Description

Description

PPM1M Polyclonal specifically detects PPM1M in Human samples. It is validated for Western Blot.
Specifications

Specifications

PPM1M
Polyclonal
Rabbit
Protein Phosphatase
Q96MI6
132160
Synthetic peptides corresponding to PPM1M (protein phosphatase, Mg2+/Mn2+ dependent, 1M) The peptide sequence was selected from the middle region of PPM1M. Peptide sequence VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ32332, PP2CEEC 3.1.3.16, PP2Ceta, PP2C-eta, PPM1E, protein phosphatase 1M, protein phosphatase 1M (PP2C domain containing), protein phosphatase 2C eta, protein phosphatase 2C eta-2, Protein phosphatase 2C isoform eta, protein phosphatase, Mg2+/Mn2+ dependent, 1M
PPM1M
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit