Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP1R3B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen PPP1R3B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179917
View Documents
Novus Biologicals
NBP179917
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

PPP1R3B Polyclonal specifically detects PPP1R3B in Human samples. It is validated for Western Blot.
Specifications

Specifications

PPP1R3B
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ14005, FLJ34675, GL, Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, PPP1R4PP1 subunit R4, protein phosphatase 1 regulatory subunit 3B, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL, protein phosphatase 1, regulatory (inhibitor) subunit 3B
PPP1R3B
IgG
Affinity Purified
31 kDa
Western Blot
Unconjugated
RUO
NP_078883
79660
The immunogen for this antibody is PPP1R3B. Peptide sequence LSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit