Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP2R5A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153663

 View more versions of this product

Catalog No. NBP153663


Add to cart

Description

Description

PPP2R5A Polyclonal antibody specifically detects PPP2R5A in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

PPP2R5A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PPP2R5A
Synthetic peptides corresponding to PPP2R5A(protein phosphatase 2, regulatory subunit B', alpha isoform) The peptide sequence was selected from the N terminal of PPP2R5A. Peptide sequence YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW.
56 kDa
100 ul
Wnt Signaling Pathway
Primary
5525
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q15172
B56A, MGC131915, PP2A B subunit isoform B56-alpha, PP2A B subunit isoform B'-alpha, PP2A B subunit isoform PR61-alpha, PP2A B subunit isoform R5-alpha, PP2A, B subunit, B' alpha isoform, PP2A, B subunit, B56 alpha isoform, PP2A, B subunit, PR61 alpha isoform, PP2A, B subunit, R5 alpha isoform, PR61A, PR61alpha, protein phosphatase 2, regulatory subunit B (B56), alpha isoform, protein phosphatase 2, regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alphaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Goat: 86%.
Bovine, Canine, Equine, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit