PPP2R5A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15366320UL

Catalog No. NBP15366320

Description

PPP2R5A Polyclonal specifically detects PPP2R5A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPP2R5A
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q15172
• Gene Symbols: PPP2R5A
• Immunogen: Synthetic peptides corresponding to PPP2R5A(protein phosphatase 2, regulatory subunit B', alpha isoform) The peptide sequence was selected from the N terminal of PPP2R5A. Peptide sequence YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B56A, MGC131915, PP2A B subunit isoform B56-alpha, PP2A B subunit isoform B'-alpha, PP2A B subunit isoform PR61-alpha, PP2A B subunit isoform R5-alpha, PP2A, B subunit, B' alpha isoform, PP2A, B subunit, B56 alpha isoform, PP2A, B subunit, PR61 alpha isoform, PP2A, B subunit, R5 alpha isoform, PR61A, PR61alpha, protein phosphatase 2, regulatory subunit B (B56), alpha isoform, protein phosphatase 2, regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alphaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 20 μL
• Research Discipline: Wnt Signaling Pathway
• Gene ID (Entrez): 5525
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.