PQLC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162482

Catalog No. NBP162482

Description

PQLC1 Polyclonal specifically detects PQLC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PQLC1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N2U9
• Gene Symbols: PQLC1
• Immunogen: Synthetic peptides corresponding to PQLC1(PQ loop repeat containing 1) The peptide sequence was selected from the middle region of PQLC1. Peptide sequence TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80148
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ22378, PQ loop repeat containing 1, PQ-loop repeat-containing protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.