Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PQLC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PQLC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162482
|
Novus Biologicals
NBP162482 |
100 μL |
Each of 1 for $436.00
|
|
Description
PQLC1 Polyclonal specifically detects PQLC1 in Human samples. It is validated for Western Blot.Specifications
PQLC1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ22378, PQ loop repeat containing 1, PQ-loop repeat-containing protein 1 | |
PQLC1 | |
IgG | |
Affinity Purified | |
30 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8N2U9 | |
80148 | |
Synthetic peptides corresponding to PQLC1(PQ loop repeat containing 1) The peptide sequence was selected from the middle region of PQLC1. Peptide sequence TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title