PR48 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15817420UL

Catalog No. NBP15817420

Description

PR48 Polyclonal specifically detects PR48 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PR48
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9Y5P8
• Gene Symbols: PPP2R3B
• Immunogen: Synthetic peptides corresponding to PPP2R3B(protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta) The peptide sequence was selected from the C terminal of PPP2R3B. Peptide sequence ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALR
• Quantity: 20 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 28227
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: FLJ60425, NYREN8, NY-REN-8 antigen, PP2A subunit B isoform PR48, PP2A, subunit B, PR48 isoform, PPP2R3L, PPP2R3LY, PR48, protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta, protein phosphatase 2, regulatory subunit B'', beta, Protein phosphatase 2A 48 kDa regulatory subunit, serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: B.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.