Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

PRAMEF2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen PRAMEF2
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124746
View Documents
Novus Biologicals
NBP30992225UL
25 μg
Each for $106.19
N/A
NB124745
View Documents
Novus Biologicals
NBP309922100UL
100 μg
Each for $352.89
N/A
Description

Description

PRAMEF2 Polyclonal antibody specifically detects PRAMEF2 in Human samples. It is validated for Western Blot
Specifications

Specifications

PRAMEF2
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
65122
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
DJ845O24.3, FLJ43580, PRAME family member 2, RP5-845O24.1
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRAMEF2 (NP_075390). Peptide sequence VRVNWEIFTPLRAELMCTLREFRQPKRIFIGPTPCPSCGSSPSEELELHL
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit