Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRAS40 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PRAS40 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155261
|
Novus Biologicals
NBP155261 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PRAS40 Polyclonal specifically detects PRAS40 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PRAS40 | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 40 kDa, AKT1 substrate 1 (proline-rich), MGC2865, proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate | |
| AKT1S1 | |
| IgG | |
| Affinity Purified | |
| 27 kDa |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Autophagy, Cancer, Growth and Development, Lipid and Metabolism, mTOR Pathway, Neuronal Cell Markers, Neuroscience, Tumor Suppressors | |
| Q96B36 | |
| 84335 | |
| Synthetic peptides corresponding to AKT1S1(AKT1 substrate 1 (proline-rich)) The peptide sequence was selected from the C terminal of AKT1S1. Peptide sequence KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title