Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRDM12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | PRDM12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179697
|
Novus Biologicals
NBP179697 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
PRDM12 Polyclonal specifically detects PRDM12 in Mouse samples. It is validated for Western Blot.Specifications
PRDM12 | |
Polyclonal | |
Rabbit | |
NP_001116834 | |
59335 | |
The immunogen for this antibody is Prdm12. Peptide sequence MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PFM9, PR domain containing 12, PR domain zinc finger protein 12, PR domain-containing protein 12, PR-domain containing protein 12, PR-domain zinc finger protein 12 | |
PRDM12 | |
IgG | |
40 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title