Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRDM12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PRDM12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PRDM12 Polyclonal specifically detects PRDM12 in Mouse samples. It is validated for Western Blot.Specifications
PRDM12 | |
Polyclonal | |
Rabbit | |
NP_001116834 | |
59335 | |
The immunogen for this antibody is Prdm12. Peptide sequence MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PFM9, PR domain containing 12, PR domain zinc finger protein 12, PR domain-containing protein 12, PR-domain containing protein 12, PR-domain zinc finger protein 12 | |
PRDM12 | |
IgG | |
40 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title