Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRDM13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18036020UL
Description
PRDM13 Polyclonal specifically detects PRDM13 in Human samples. It is validated for Western Blot.Specifications
PRDM13 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_067633 | |
PRDM13 | |
Synthetic peptide directed towards the N terminal of human PRDM13. Peptide sequence HGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRM. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
PR domain containing 13, PR domain zinc finger protein 13 | |
Rabbit | |
Affinity Purified | |
RUO | |
59336 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction