Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRDM13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | PRDM13 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18036020
|
Novus Biologicals
NBP18036020UL |
20 μL |
Each for $152.22
|
|
NBP180360
|
Novus Biologicals
NBP180360 |
100 μL |
Each for $436.00
|
|
Description
PRDM13 Polyclonal specifically detects PRDM13 in Human samples. It is validated for Western Blot.Specifications
PRDM13 | |
Polyclonal | |
Rabbit | |
NP_067633 | |
59336 | |
Synthetic peptide directed towards the N terminal of human PRDM13. Peptide sequence HGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRM. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PR domain containing 13, PR domain zinc finger protein 13 | |
PRDM13 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title