Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRDM15 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152842

 View more versions of this product

Catalog No. NBP152842


Add to cart

Description

Description

PRDM15 Polyclonal antibody specifically detects PRDM15 in Human, Mouse, Rat, Bovine, Canine, Guinea Pig samples. It is validated for Western Blot.
Specifications

Specifications

PRDM15
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
C21orf83, chromosome 21 open reading frame 83, PFM15, PR domain containing 15, PR domain zinc finger protein 15, PR domain-containing protein 15, Zinc finger protein 298, ZNF298
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 78%.
Bovine, Canine, Guinea Pig, Human, Mouse, Rat
Western Blot
Western Blot 1:100-1:2000
Affinity Purified
PRDM15
Synthetic peptides corresponding to PRDM15(PR domain containing 15) The peptide sequence was selected from the middle region of PRDM15. Peptide sequence LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP.
Immunogen affinity purified
RUO
Primary
63977
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit