Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM131C Rabbit anti-Human, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP17960720UL
Description
FAM131C Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
FAM131C | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Affinity Purified | |
FAM131C | |
Synthetic peptide directed towards the middle region of human FAM131CThe immunogen for this antibody is FAM131C. Peptide sequence RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF. | |
Immunogen affinity purified | |
RUO | |
Primary | |
348487 |
Western Blot | |
Western Blot 0.2-1 ug/ml | |
NP_872429 | |
C1orf117, family with sequence similarity 131, member C, FLJ36766, hypothetical protein LOC348487, RP11-5P18.9 | |
Rabbit | |
IgG | |
20ul | |
Store at -20C. Avoid freeze-thaw cycles. | |
Polyclonal | |
Human |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title