Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LUC7L Rabbit anti-Human, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP17969520UL
Description
LUC7L Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
LUC7L | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Affinity Purified | |
LUC7L | |
Synthetic peptide directed towards the middle region of human LUC7LThe immunogen for this antibody is LUC7L. Peptide sequence EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS. | |
36 kDa | |
20ul | |
Store at -20C. Avoid freeze-thaw cycles. | |
Polyclonal | |
Human |
Western Blot | |
Western Blot 1:1000 | |
NP_060502 | |
FLJ10231, hLuc7B1, Luc7, LUC7 (S. cerevisiae)-like, LUC7B1, LUC7L1, LUC7-LIKE, LUC7-like (S. cerevisiae), putative RNA-binding protein Luc7-like 1, Putative SR protein LUC7B1, sarcoplasmic reticulum protein LUC7B1, SR+89 | |
Rabbit | |
IgG | |
Immunogen affinity purified | |
RUO | |
Primary | |
55692 |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title