Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRL7A2 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310233100UL
Description
PRL7A2 Polyclonal specifically detects PRL7A2 in Rat samples. It is validated for Western Blot.Specifications
PRL7A2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
PL | |
The immunogen is a synthetic peptide directed towards the middle region of mouse PRL7A2 (NP_035298.1). Peptide sequence TYTVNQVSEKLYENYMLDFIEDMEYLVKALTCCHNYSIKTPENLDEAQQI | |
100 μg | |
Primary | |
Rat | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
19114 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction