Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Promega PDK1 Kinase Enzyme System

Recombinant full-length human PDK1 was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. PDK1 (3-phosphoinositide-dependent protein kinase) is activated by the presence of PtdIns(3,4,5)P3 or PtdIns(3,4)P2.

$559.00 - $1153.00

Specifications

Product Type PDK1 Kinase Enzyme system
Includes 10μg Recombinant PDK1 Kinase, PDKtide ([protein fragment, 39 aa]) Substrate, Reaction Buffer, DTT and MnCl2
Molecular Weight 67
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Content And Storage Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Content And Storage Price Quantity & Availability  
PRV9681
View Documents
Promega
V9681
1/ea COMPONENTS AT DIFFERENT TEMPS
Each for $1,153.00
Add to cart
 
PRV2761
View Documents
Promega
V2761
10μg <−65°C
Each for $559.00
Add to cart
 
Description

Description

  • Easily Screen and Profile PDK1 Kinase Inhibitors
  • Includes kinase, substrate and reaction buffer
  • Use with ADP-Glo™ Assay for bioluminescent detection of kinase activity
Specifications

Specifications

PDK1 Kinase Enzyme system
10μg Recombinant PDK1 Kinase, PDKtide ([protein fragment, 39 aa]) Substrate, Reaction Buffer, DTT and MnCl2
67
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit