Proprotein Convertase 2/PCSK2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169146

Catalog No. NBP169146

Description

Proprotein Convertase 2/PCSK2 Polyclonal specifically detects Proprotein Convertase 2/PCSK2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Proprotein Convertase 2/PCSK2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 3.4.21, EC 3.4.21.94, KEX2-like endoprotease 2, NEC 2, NEC2SPC2, neuroendocrine convertase 2, PC2NEC-2, Prohormone convertase 2, Proprotein convertase 2, proprotein convertase subtilisin/kexin type 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Research Discipline: Chromatin Research, Golgi Apparatus Markers, Neuroscience
• Gene ID (Entrez): 5126
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PCSK2
• Immunogen: Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.