Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Proprotein Convertase 2/PCSK2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | Proprotein Convertase 2/PCSK2 |
|---|---|
| Immunogen | Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16914620 |
Novus Biologicals
NBP16914620UL |
20ul |
Each for $149.00
|
|
NBP169146 |
Novus Biologicals
NBP169146 |
100 ul |
Each for $329.00
|
|
Description
Proprotein Convertase 2/PCSK2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| Proprotein Convertase 2/PCSK2 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 5126 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA. | |
| Primary | |
| IgG | |
| EC 3.4.21, EC 3.4.21.94, KEX2-like endoprotease 2, NEC 2, NEC2SPC2, neuroendocrine convertase 2, PC2NEC-2, Prohormone convertase 2, Proprotein convertase 2, proprotein convertase subtilisin/kexin type 2 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title