Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Proprotein Convertase 2/PCSK2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Proprotein Convertase 2/PCSK2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP169146
|
Novus Biologicals
NBP169146 |
100 μL |
Each for $436.00
|
|
NBP16914620
|
Novus Biologicals
NBP16914620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Proprotein Convertase 2/PCSK2 Polyclonal specifically detects Proprotein Convertase 2/PCSK2 in Human samples. It is validated for Western Blot.Specifications
Proprotein Convertase 2/PCSK2 | |
Polyclonal | |
Rabbit | |
Chromatin Research, Golgi Apparatus Markers, Neuroscience | |
EC 3.4.21, EC 3.4.21.94, KEX2-like endoprotease 2, NEC 2, NEC2SPC2, neuroendocrine convertase 2, PC2NEC-2, Prohormone convertase 2, Proprotein convertase 2, proprotein convertase subtilisin/kexin type 2 | |
PCSK2 | |
IgG | |
Affinity Purified | |
58 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
5126 | |
Synthetic peptides corresponding to PCSK2 (proprotein convertase subtilisin/kexin type 2) The peptide sequence was selected from the middle region of PCSK2. Peptide sequence LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title