Prostaglandin I2 Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16239020UL

Catalog No. NBP16239020

Description

Prostaglandin I2 Synthase Polyclonal specifically detects Prostaglandin I2 Synthase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Prostaglandin I2 Synthase
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: Q16647
• Gene Symbols: PTGIS
• Immunogen: Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5740
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CYP8A1PTGI, CYP8prostacyclin synthase, EC 5.3.99.4, MGC126858, MGC126860, PGIScytochrome P450, family 8, subfamily A, polypeptide 1, prostaglandin I2 (prostacyclin) synthase, Prostaglandin I2 synthase
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG