Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Prostaglandin I2 Synthase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Prostaglandin I2 Synthase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16239020
View Documents
Novus Biologicals
NBP16239020UL
20 μL
Each for $152.22
Add to cart
 
NBP162390
View Documents
Novus Biologicals
NBP162390
100 μL
Each for $436.00
Add to cart
 
Description

Description

Prostaglandin I2 Synthase Polyclonal specifically detects Prostaglandin I2 Synthase in Human samples. It is validated for Western Blot.
Specifications

Specifications

Prostaglandin I2 Synthase
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
CYP8A1PTGI, CYP8prostacyclin synthase, EC 5.3.99.4, MGC126858, MGC126860, PGIScytochrome P450, family 8, subfamily A, polypeptide 1, prostaglandin I2 (prostacyclin) synthase, Prostaglandin I2 synthase
PTGIS
IgG
Affinity Purified
57 kDa
Western Blot
Unconjugated
RUO
Q16647
5740
Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit