Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Prostaglandin I2 Synthase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Prostaglandin I2 Synthase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16239020
|
Novus Biologicals
NBP16239020UL |
20 μL |
Each for $152.22
|
|
NBP162390
|
Novus Biologicals
NBP162390 |
100 μL |
Each for $436.00
|
|
Description
Prostaglandin I2 Synthase Polyclonal specifically detects Prostaglandin I2 Synthase in Human samples. It is validated for Western Blot.Specifications
| Prostaglandin I2 Synthase | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CYP8A1PTGI, CYP8prostacyclin synthase, EC 5.3.99.4, MGC126858, MGC126860, PGIScytochrome P450, family 8, subfamily A, polypeptide 1, prostaglandin I2 (prostacyclin) synthase, Prostaglandin I2 synthase | |
| PTGIS | |
| IgG | |
| Affinity Purified | |
| 57 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q16647 | |
| 5740 | |
| Synthetic peptides corresponding to PTGIS(prostaglandin I2 (prostacyclin) synthase) The peptide sequence was selected from the middle region of PTGIS. Peptide sequence EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title