Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Prosurfactant Protein C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP160117
Description
Prosurfactant Protein C Polyclonal specifically detects Prosurfactant Protein C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Prosurfactant Protein C | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
PSP-C, pulmonary surfactant-associated protein C, Pulmonary surfactant-associated proteolipid SPL(Val), SFTP2, SFTP2pulmonary surfactant apoprotein-2 SP-C, SMDP2surfactant, pulmonary-associated protein C, SP-CSP5, surfactant protein C | |
Rabbit | |
21 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10 - 1:500, Immunohistochemistry-Paraffin 1:10 - 1:500 | |
P11686 | |
SFTPC | |
Synthetic peptide corresponding to SFTPC (surfactant, pulmonary-associated protein C). The peptide sequence was selected from the N terminal of SFTPC. Peptide sequence MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI. The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
6440 | |
Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit, Sheep | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction