Proteasome 20S alpha 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154374

Catalog No. NBP154374

Description

Proteasome 20S alpha 3 Polyclonal specifically detects Proteasome 20S alpha 3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Proteasome 20S alpha 3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.25.1, HC8MGC32631, Macropain subunit C8, MGC12306, Multicatalytic endopeptidase complex subunit C8, proteasome (prosome, macropain) subunit, alpha type, 3, Proteasome component C8, proteasome subunit alpha type-3, proteasome subunit C8, PSC3, PSC8
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 5684
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P25788-2
• Gene Symbols: PSMA3
• Immunogen: Synthetic peptides corresponding to PSMA3(proteasome (prosome, macropain) subunit, alpha type, 3) The peptide sequence was selected from the middle region of PSMA3. Peptide sequence VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha type-3.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG