Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Proteasome 20S alpha 3 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154374

 View more versions of this product

Catalog No. NBP154374


Add to cart

Description

Description

Proteasome 20S alpha 3 Polyclonal antibody specifically detects Proteasome 20S alpha 3 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Proteasome 20S alpha 3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PSMA3
Synthetic peptides corresponding to PSMA3(proteasome (prosome, macropain) subunit, alpha type, 3) The peptide sequence was selected from the middle region of PSMA3. Peptide sequence VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN.
28 kDa
100 ul
Stem Cell Markers
Primary
5684
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
P25788-2
EC 3.4.25.1, HC8MGC32631, Macropain subunit C8, MGC12306, Multicatalytic endopeptidase complex subunit C8, proteasome (prosome, macropain) subunit, alpha type, 3, Proteasome component C8, proteasome subunit alpha type-3, proteasome subunit C8, PSC3, PSC8
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: alpha type-3.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit