Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Proteasome beta 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Proteasome beta 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Proteasome beta 1 Polyclonal specifically detects Proteasome beta 1 in Human samples. It is validated for Western Blot.Specifications
| Proteasome beta 1 | |
| Polyclonal | |
| Rabbit | |
| P20618 | |
| 5689 | |
| Synthetic peptides corresponding to PSMB1(proteasome (prosome, macropain) subunit, beta type, 1) The peptide sequence was selected from the middle region of PSMB1 (NP_002784). Peptide sequence NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG. | |
| Primary | |
| 26 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.4.25.1, FLJ25321, HC5, KIAA1838, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, PMSB1, proteasome (prosome, macropain) subunit, beta type, 1, proteasome beta 1 subunit, Proteasome component C5, Proteasome gamma chain, proteasome subunit beta type-1, proteasome subunit HC5, PSC5 | |
| PSMB1 | |
| IgG | |
| This product is specific to Subunit or Isoform: beta type-1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title