Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Proteasome beta 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15458320UL

 View more versions of this product

Catalog No. NBP15458320

Add to cart



Proteasome beta 1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


Proteasome beta 1
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to PSMB1(proteasome (prosome, macropain) subunit, beta type, 1) The peptide sequence was selected from the middle region of PSMB1 (NP_002784). Peptide sequence NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG.
26 kDa
Store at -20C. Avoid freeze-thaw cycles.
This product is specific to Subunit or Isoform: beta type-1.
Western Blot
Western Blot 0.2-1 ug/ml
EC, FLJ25321, HC5, KIAA1838, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, PMSB1, proteasome (prosome, macropain) subunit, beta type, 1, proteasome beta 1 subunit, Proteasome component C5, Proteasome gamma chain, proteasome subunit beta type-1, proteasome subunit HC5, PSC5
Immunogen affinity purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit