Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Proteasome subunit beta type 4 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154592

 View more versions of this product

Catalog No. NBP154592

Add to cart



Proteasome subunit beta type 4 Polyclonal antibody specifically detects Proteasome subunit beta type 4 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.


Proteasome subunit beta type 4
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to PSMB4(proteasome (prosome, macropain) subunit, beta type, 4) The peptide sequence was selected from the middle region of PSMB4 (NP_002787). Peptide sequence YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV.
29 kDa
100 ul
Stem Cell Markers
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 0.2-1 ug/ml
EC, HN3, hsBPROS26, HsN3, Macropain beta chain, Multicatalytic endopeptidase complex beta chain, PROS26PROS-26, proteasome (prosome, macropain) subunit, beta type, 4, Proteasome beta chain, Proteasome chain 3, proteasome subunit beta type-4, proteasome subunit HsN3, proteasome subunit, beta type, 4,26 kDa prosomal protein
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
This product is specific to Subunit or Isoform: beta type-4.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit