Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protein Kinase A Regulatory Subunit II alpha Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309404100UL
Description
Protein Kinase A Regulatory Subunit II alpha Polyclonal specifically detects Protein Kinase A Regulatory Subunit II alpha in Human samples. It is validated for Western Blot.Specifications
Protein Kinase A Regulatory Subunit II alpha | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Rabbit | |
Affinity purified | |
RUO | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
The immunogen is a synthetic peptide directed towards the C terminal region of human Protein Kinase A Regulatory Subunit II alpha (NP_004148). Peptide sequence IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS | |
100 μg | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction