Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protocadherin-12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15920520UL
Description
Protocadherin-12 Polyclonal specifically detects Protocadherin-12 in Human samples. It is validated for Western Blot.Specifications
Protocadherin-12 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NPG4 | |
PCDH12 | |
Synthetic peptides corresponding to PCDH12(protocadherin 12) The peptide sequence was selected from the middle region of PCDH12. Peptide sequence SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
protocadherin 12, Vascular cadherin-2, vascular endothelial cadherin 2, Vascular endothelial cadherin-2, VE-cad-2, VECAD2, VE-cadherin 2, VE-cadherin-2protocadherin-12 | |
Rabbit | |
Affinity Purified | |
RUO | |
51294 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title