Protocadherin-12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159205

Catalog No. NBP159205

Description

Protocadherin-12 Polyclonal specifically detects Protocadherin-12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Protocadherin-12
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NPG4
• Gene Symbols: PCDH12
• Immunogen: Synthetic peptides corresponding to PCDH12(protocadherin 12) The peptide sequence was selected from the middle region of PCDH12. Peptide sequence SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Pig: 92%; Equine: 85%; Bovine: 84%; Guinea pig: 84%; Rat: 78%.
• Target Species: Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: protocadherin 12, Vascular cadherin-2, vascular endothelial cadherin 2, Vascular endothelial cadherin-2, VE-cad-2, VECAD2, VE-cadherin 2, VE-cadherin-2protocadherin-12
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51294
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.