Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Protocadherin alpha 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Protocadherin alpha 4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Protocadherin alpha 4 Polyclonal specifically detects Protocadherin alpha 4 in Human samples. It is validated for Western Blot.Specifications
Protocadherin alpha 4 | |
Polyclonal | |
Rabbit | |
CNR1, CNRN1, CRNR1, KIAA0345-like 10, MGC138307, MGC142169, ortholog of mouse CNR1, PCDH-alpha-4, PCDH-ALPHA4, protocadherin alpha 4, protocadherin alpha-4 | |
PCDHA4 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
56144 | |
Synthetic peptides corresponding to PCDHA4(protocadherin alpha 4) The peptide sequence was selected from the N terminal of PCDHA4. Peptide sequence VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title