Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRPF4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PRPF4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157150
|
Novus Biologicals
NBP157150 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PRPF4 Polyclonal specifically detects PRPF4 in Human samples. It is validated for Western Blot.Specifications
| PRPF4 | |
| Polyclonal | |
| Rabbit | |
| O43172 | |
| 9128 | |
| Synthetic peptides corresponding to PRPF4(PRP4 pre-mRNA processing factor 4 homolog (yeast)) The peptide sequence was selected from the N terminal of PRPF4. Peptide sequence EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hPrp4, HPRP4P, HPRP4PRP4/STK/WD splicing factor, PRP4 homolog, PRP4 pre-mRNA processing factor 4 homolog (yeast), Prp4p, PRP4WD splicing factor Prp4, U4/U6 small nuclear ribonucleoprotein Prp4, U4/U6 snRNP 60 kDa protein | |
| PRPF4 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title