Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRR5L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PRR5L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157689
|
Novus Biologicals
NBP157689 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PRR5L Polyclonal specifically detects PRR5L in Human samples. It is validated for Western Blot.Specifications
| PRR5L | |
| Polyclonal | |
| Rabbit | |
| Q6MZQ0 | |
| 79899 | |
| Synthetic peptides corresponding to FLJ14213(protor-2) The peptide sequence was selected from the middle region of FLJ14213. Peptide sequence LNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ14213MGC16218, FLJ22630, proline rich 5 like, Protein observed with Rictor-2, protor-2, PROTOR2proline-rich protein 5-like | |
| PRR5L | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title