Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRRG3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17932520UL

 View more versions of this product

Catalog No. NBP17932520


Add to cart

Description

Description

PRRG3 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

PRRG3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PRRG3
The immunogen for this antibody is Prrg3. Peptide sequence MAVFLEAKNAHAVLKRFPRANEFLEELRQGTIERECMEEICSYEEVKEVF.
Immunogen affinity purified
RUO
Primary
79057
Western Blot
Western Blot 1:1000
NP_001074604
PRGP3MGC156177, proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane), Proline-rich gamma-carboxyglutamic acid protein 3, Proline-rich Gla protein 3, TMG3MGC149510, transmembrane gamma-carboxyglutamic acid protein 3
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit