Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PRSS35 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PRSS35 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158042
|
Novus Biologicals
NBP158042 |
100 μL |
Each for $436.00
|
|
NBP15804220
|
Novus Biologicals
NBP15804220UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PRSS35 Polyclonal specifically detects PRSS35 in Human samples. It is validated for Western Blot.Specifications
| PRSS35 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C6orf158, chromosome 6 open reading frame 158, dJ223E3.1, EC 3.4.21, EC 3.4.21.4, inactive serine protease 35, MGC46520, protease, serine, 35 | |
| PRSS35 | |
| IgG | |
| Affinity Purified | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N3Z0 | |
| 167681 | |
| Synthetic peptides corresponding to PRSS35(protease, serine, 35) The peptide sequence was selected from the N terminal of PRSS35. Peptide sequence PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title