Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PRSS35 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen PRSS35
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158042
View Documents
Novus Biologicals
NBP158042
100 μL
Each for $436.00
Add to cart
 
NBP15804220
View Documents
Novus Biologicals
NBP15804220UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

PRSS35 Polyclonal specifically detects PRSS35 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PRSS35
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
C6orf158, chromosome 6 open reading frame 158, dJ223E3.1, EC 3.4.21, EC 3.4.21.4, inactive serine protease 35, MGC46520, protease, serine, 35
PRSS35
IgG
Affinity Purified
47 kDa
Western Blot
Unconjugated
RUO
Q8N3Z0
167681
Synthetic peptides corresponding to PRSS35(protease, serine, 35) The peptide sequence was selected from the N terminal of PRSS35. Peptide sequence PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit