Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155338
Description
PSD3 Polyclonal specifically detects PSD3 in Human samples. It is validated for Western Blot.Specifications
PSD3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q9NYI0-2 | |
PSD3 | |
Synthetic peptides corresponding to PSD3(pleckstrin and Sec7 domain containing 3) The peptide sequence was selected from the middle region of PSD3. Peptide sequence PDSYFSFEMPLTPMIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGY. | |
Affinity Purified | |
RUO | |
23362 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
ADP-ribosylation factor guanine nucleotide factor 6, DKFZp761K1423, EFA6RHepatocellular carcinoma-associated antigen 67, Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6, HCA67Pleckstrin homology and SEC7 domain-containing protein 3, KIAA0942, PH and SEC7 domain-containing protein 3, pleckstrin and Sec7 domain containing 3 | |
Rabbit | |
116 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction