Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen PSD3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155338
View Documents
Novus Biologicals
NBP155338
100 μL
Each for $436.00
Add to cart
 
NBP15533820
View Documents
Novus Biologicals
NBP15533820UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

PSD3 Polyclonal specifically detects PSD3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PSD3
Polyclonal
Rabbit
Q9NYI0-2
23362
Synthetic peptides corresponding to PSD3(pleckstrin and Sec7 domain containing 3) The peptide sequence was selected from the middle region of PSD3. Peptide sequence PDSYFSFEMPLTPMIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGY.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
ADP-ribosylation factor guanine nucleotide factor 6, DKFZp761K1423, EFA6RHepatocellular carcinoma-associated antigen 67, Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6, HCA67Pleckstrin homology and SEC7 domain-containing protein 3, KIAA0942, PH and SEC7 domain-containing protein 3, pleckstrin and Sec7 domain containing 3
PSD3
IgG
Affinity Purified
116 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit