Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PSD3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155338
|
Novus Biologicals
NBP155338 |
100 μL |
Each for $436.00
|
|
NBP15533820
|
Novus Biologicals
NBP15533820UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PSD3 Polyclonal specifically detects PSD3 in Human samples. It is validated for Western Blot.Specifications
PSD3 | |
Polyclonal | |
Rabbit | |
Q9NYI0-2 | |
23362 | |
Synthetic peptides corresponding to PSD3(pleckstrin and Sec7 domain containing 3) The peptide sequence was selected from the middle region of PSD3. Peptide sequence PDSYFSFEMPLTPMIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGY. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
ADP-ribosylation factor guanine nucleotide factor 6, DKFZp761K1423, EFA6RHepatocellular carcinoma-associated antigen 67, Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6, HCA67Pleckstrin homology and SEC7 domain-containing protein 3, KIAA0942, PH and SEC7 domain-containing protein 3, pleckstrin and Sec7 domain containing 3 | |
PSD3 | |
IgG | |
Affinity Purified | |
116 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title