Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSD93 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159715
Description
PSD93 Polyclonal specifically detects PSD93 in Human samples. It is validated for Western Blot.Specifications
| PSD93 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Q15700 | |
| DLG2 | |
| Synthetic peptides corresponding to DLG2(discs, large homolog 2, chapsyn-110 (Drosophila)) The peptide sequence was selected from the N terminal of DLG2. Peptide sequence MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Chapsyn-110, discs, large homolog 2 (Drosophila), discs, large homolog 2, chapsyn-110, discs, large homolog 2, chapsyn-110 (Drosophila), disks large homolog 2, DKFZp781D1854, DKFZp781E0954, FLJ37266, MGC131811, Postsynaptic density protein PSD-93, PSD-93, PSD93,110kDa | |
| Rabbit | |
| 97 kDa | |
| 100 μL | |
| Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision | |
| 1740 | |
| Human, Mouse, Rat, Guinea Pig, Zebrafish | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title