Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSD93 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | PSD93 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15971520
|
Novus Biologicals
NBP15971520UL |
20 μL |
Each for $152.22
|
|
NBP159715
|
Novus Biologicals
NBP159715 |
100 μL |
Each for $436.00
|
|
Description
PSD93 Polyclonal specifically detects PSD93 in Human samples. It is validated for Western Blot.Specifications
PSD93 | |
Polyclonal | |
Rabbit | |
Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision | |
Q15700 | |
1740 | |
Synthetic peptides corresponding to DLG2(discs, large homolog 2, chapsyn-110 (Drosophila)) The peptide sequence was selected from the N terminal of DLG2. Peptide sequence MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Chapsyn-110, discs, large homolog 2 (Drosophila), discs, large homolog 2, chapsyn-110, discs, large homolog 2, chapsyn-110 (Drosophila), disks large homolog 2, DKFZp781D1854, DKFZp781E0954, FLJ37266, MGC131811, Postsynaptic density protein PSD-93, PSD-93, PSD93,110kDa | |
DLG2 | |
IgG | |
Affinity Purified | |
97 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title