Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSD93 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$204.00 - $482.50

Specifications

Antigen PSD93
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15971520
SDP
View Documents
Novus Biologicals
NBP15971520UL
20 μL
Each for $204.00
Add to Cart
 
NBP159715
SDP
View Documents
Novus Biologicals
NBP159715
100 μL
Each for $482.50
Add to Cart
 
Description

Description

PSD93 Polyclonal specifically detects PSD93 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PSD93
Polyclonal
Rabbit
Neuronal Cell Markers, Neuroscience, Neurotransmission, Vision
Chapsyn-110, discs, large homolog 2 (Drosophila), discs, large homolog 2, chapsyn-110, discs, large homolog 2, chapsyn-110 (Drosophila), disks large homolog 2, DKFZp781D1854, DKFZp781E0954, FLJ37266, MGC131811, Postsynaptic density protein PSD-93, PSD-93, PSD93,110kDa
DLG2
IgG
97 kDa
Western Blot
Unconjugated
RUO
Q15700
1740
Synthetic peptides corresponding to DLG2(discs, large homolog 2, chapsyn-110 (Drosophila)) The peptide sequence was selected from the N terminal of DLG2. Peptide sequence MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS.
Primary
SDS
Documents

Documents

Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit