PSG-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP158028

Catalog No. NBP158028

Description

PSG1 Polyclonal specifically detects PSG1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PSG1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6ICR4
• Gene Symbols: PSG1
• Immunogen: Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the C terminal of PSG1. Peptide sequence YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5669
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B1G1CD66 antigen-like family member F, CD66f, CD66f antigen, DHFRP2, Fetal liver non-specific cross-reactive antigen 1/2, FLJ90598, FLJ90654, FL-NCA-1/2, PBG1, pregnancy specific beta-1-glycoprotein 1, pregnancy-specific B-1 glycoprotein, Pregnancy-specific beta-1 glycoprotein C/D, pregnancy-specific beta-1-glycoprotein 1, Pregnancy-specific glycoprotein 1, PS-beta-C/D, PS-beta-G-1, PSBG-1, PSBG1SP1, PSGGAPSG95, PSGIIA
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG