Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PSMC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191476
Description
PSMC1 Polyclonal specifically detects PSMC1 in Mouse samples. It is validated for Western Blot, Simple Western.Specifications
PSMC1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541 | |
Rabbit | |
48 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Xenopus: 100%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Simple Western | |
P62192 | |
PSMC1 | |
Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG. | |
Affinity purified | |
RUO | |
5700 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction