Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PSMC1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19147620UL

 View more versions of this product

Catalog No. NBP19147620


Add to cart

Description

Description

PSMC1 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

PSMC1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PSMC1
Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG.
48 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1.0 ug/ml
P62192
26S protease regulatory subunit 4, 26S proteasome AAA-ATPase subunit RPT2, MGC24583, P26S4, p56, proteasome (prosome, macropain) 26S subunit, ATPase, 1, proteasome 26S ATPase subunit 1, Proteasome 26S subunit ATPase 1, proteasome 26S subunit, ATPase, 1, S4MGC8541
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
5700
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit